Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccna2 Peptide - C-terminal region

Ccna2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC156527, Ccna2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccna2 Rabbit Polyclonal Antibody (orb573588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_446154

Preservative

Lyophilized powder

AA Sequence

TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ube2cbp Mouse Gene Knockout Kit (CRISPR)
KN518565 1 Kit

Ube2cbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tropomyosin 2 (TPM2) (NM_003289) Human Over-expression Lysate
LY418786 100 µg

Tropomyosin 2 (TPM2) (NM_003289) Human Over-expression Lysate

Sign In for Pricing
View Details
NucView® 488 Caspase 3 Assay Kit
#30029 1 Kit

NucView® 488 Caspase 3 Assay Kit

Sign In for Pricing
View Details
FERD3L Polyclonal Antibody
E-AB-17959-01 20 µL

FERD3L Polyclonal Antibody

Sign In for Pricing
View Details
FERD3L Polyclonal Antibody
E-AB-17959-02 60 µL

FERD3L Polyclonal Antibody

Sign In for Pricing
View Details
FERD3L Polyclonal Antibody
E-AB-17959-03 120 µL

FERD3L Polyclonal Antibody

Sign In for Pricing
View Details