Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccna2 Peptide - C-terminal region

Ccna2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC156527, Ccna2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccna2 Rabbit Polyclonal Antibody (orb573588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_446154

Preservative

Lyophilized powder

AA Sequence

TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSBP2 Antibody
8C10803-AAT 50 µg

SSBP2 Antibody

Sign In for Pricing
View Details
Xkr4 Mouse Gene Knockout Kit (CRISPR)
KN519491 1 Kit

Xkr4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXO1 Rabbit Monoclonal Antibody
TA422427 100 µL

FOXO1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Dctn5 (BC005671) Mouse Tagged ORF Clone
MG200893 10 µg

Dctn5 (BC005671) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MTRR (NM_024010) Human Over-expression Lysate
LC402971 20 µg

MTRR (NM_024010) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-Hormone sensitive lipase (S660) Recombinant Rabbit monoclonal Antibody
HA723195 100 µL

Phospho-Hormone sensitive lipase (S660) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details