Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNDBP1 Peptide - middle region

CCNDBP1 Peptide - middle region

Product Specifications

Product Name Alternative

DIP1, GCIP, HHM

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNDBP1 Rabbit Polyclonal Antibody (orb582752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_411241

Preservative

Lyophilized powder

AA Sequence

NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG (Fcγ Fragment specific), AlpSdAbs® VHH
HA710245 100 µg

Mouse IgG (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
Cytochrome c-type Heme Lyase Antibody
8C12123-AAT 50 µg

Cytochrome c-type Heme Lyase Antibody

Sign In for Pricing
View Details
EZH2 / KMT6 (EZH2/2536), CF594 conjugate, 0.1mg/mL
BNC942536-100 1x 100 µL

EZH2 / KMT6 (EZH2/2536), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fumagillin
TRC-F862650-1MG 1 mg

Fumagillin

Sign In for Pricing
View Details
Recombinant Lumican Antibody
RC-5032-01 50 μL

Recombinant Lumican Antibody

Sign In for Pricing
View Details
Recombinant Lumican Antibody
RC-5032-02 100 µL

Recombinant Lumican Antibody

Sign In for Pricing
View Details