Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNDBP1 Peptide - middle region

CCNDBP1 Peptide - middle region

Product Specifications

Product Name Alternative

DIP1, GCIP, HHM

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNDBP1 Rabbit Polyclonal Antibody (orb582752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_411241

Preservative

Lyophilized powder

AA Sequence

NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Pericardium
CS803908 5x 5 µm

Tissue FFPE Sections, Pericardium

Sign In for Pricing
View Details
TMPRSS5 Rabbit Polyclonal Antibody
TA365082 100 µL

TMPRSS5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351UP-02 100 µg

PE/Elab Fluor® 594 Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
Kallikrein 15 (KLK15) (NM_017509) Human Over-expression Lysate
LY402593 100 µg

Kallikrein 15 (KLK15) (NM_017509) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit
RDR-ADAM17-Ra-01 96 Tests

Rat A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit

Sign In for Pricing
View Details