Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNJ Peptide - N-terminal region

CCNJ Peptide - N-terminal region

Product Specifications

Product Name Alternative

BA690P14.1

UniProt

Q5T5M9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNJ Rabbit Polyclonal Antibody (orb583528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061957

Preservative

Lyophilized powder

AA Sequence

FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT3 (NM_001097640) Human Over-expression Lysate
LC420414 20 µg

FUT3 (NM_001097640) Human Over-expression Lysate

Sign In for Pricing
View Details
TTC4 Human Gene Knockout Kit (CRISPR)
KN401570 1 Kit

TTC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI8D5]
CF813121 100 µg

AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI8D5]

Sign In for Pricing
View Details
ACSF2 Rabbit Polyclonal Antibody
TA370243 100 µL

ACSF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adenosine Deaminase Antibody
KC-3206-01 50 μL

Adenosine Deaminase Antibody

Sign In for Pricing
View Details
Adenosine Deaminase Antibody
KC-3206-02 100 µL

Adenosine Deaminase Antibody

Sign In for Pricing
View Details