Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNK Peptide - middle region

CCNK Peptide - middle region

Product Specifications

Product Name Alternative

CPR4, MGC9113

UniProt

C9J9Q3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNK Rabbit Polyclonal Antibody (orb585193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003849

Preservative

Lyophilized powder

AA Sequence

GDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINGO3 (C-term) Rabbit Polyclonal Antibody
AP52490PU-N 400 µL

LINGO3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Oxindole-3-acetic Acid-13C6
TRC-O850143-1MG 1 mg

Oxindole-3-acetic Acid-13C6

Sign In for Pricing
View Details
keratin 40 (KRT40) Human Gene Knockout Kit (CRISPR)
KN422348 1 Kit

keratin 40 (KRT40) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Retnla (BC029248) Mouse Tagged ORF Clone
MG200435 10 µg

Retnla (BC029248) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bauhinia purpurea Gel -BPA- Immobilized Lectin
A-2501-2 2 mL

Bauhinia purpurea Gel -BPA- Immobilized Lectin

Sign In for Pricing
View Details
ScavengePore Benzyltriethylammonium chloride, moist resin
SC11012.10G 10 g

ScavengePore Benzyltriethylammonium chloride, moist resin

Sign In for Pricing
View Details