Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNK Peptide - middle region

CCNK Peptide - middle region

Product Specifications

Product Name Alternative

CPR4, MGC9113

UniProt

C9J9Q3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNK Rabbit Polyclonal Antibody (orb585193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003849

Preservative

Lyophilized powder

AA Sequence

GDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prothrombin (F2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G10]
TA812513BM 100 µL

Prothrombin (F2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G10]

Sign In for Pricing
View Details
Pure Phaseolus lunatus Lectin (Lima Bean) -LBA-
L-1701-1 1 mg

Pure Phaseolus lunatus Lectin (Lima Bean) -LBA-

Sign In for Pricing
View Details
GFER Antibody
KC-47259-01 50 μL

GFER Antibody

Sign In for Pricing
View Details
GFER Antibody
KC-47259-02 100 µL

GFER Antibody

Sign In for Pricing
View Details
GFER Antibody
KC-47259-03 1 mL

GFER Antibody

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2965), CF740 conjugate, 0.1mg/mL
BNC742965-500 1x 500 µL

C1QB / Complement C1q B-Chain (C1QB/2965), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details