Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCS Peptide - C-terminal region

CCS Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC138260

UniProt

O14618

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCS Rabbit Polyclonal Antibody (orb584870) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005116

Preservative

Lyophilized powder

AA Sequence

LACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Licofelone
B1448-50 50 mg

Licofelone

Sign In for Pricing
View Details
Rat DNA polymerase lambda, POLL ELISA Kit
MBS9342614-01 48 Well

Rat DNA polymerase lambda, POLL ELISA Kit

Sign In for Pricing
View Details
Rat DNA polymerase lambda, POLL ELISA Kit
MBS9342614-02 96 Well

Rat DNA polymerase lambda, POLL ELISA Kit

Sign In for Pricing
View Details
Rat DNA polymerase lambda, POLL ELISA Kit
MBS9342614-03 5x 96 Well

Rat DNA polymerase lambda, POLL ELISA Kit

Sign In for Pricing
View Details
Rat DNA polymerase lambda, POLL ELISA Kit
MBS9342614-04 10x 96 Well

Rat DNA polymerase lambda, POLL ELISA Kit

Sign In for Pricing
View Details
Sars Rat shRNA Plasmid (Locus ID 266975)
TL700797 1 Kit

Sars Rat shRNA Plasmid (Locus ID 266975)

Sign In for Pricing
View Details