Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCS Peptide - middle region

CCS Peptide - middle region

Product Specifications

Product Name Alternative

MGC138260

UniProt

O14618

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCS Rabbit Polyclonal Antibody (orb584871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005116

Preservative

Lyophilized powder

AA Sequence

LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Secreted Frizzled Related Protein 4 ELISA Kit
MBS7264111-01 48 Well

Bovine Secreted Frizzled Related Protein 4 ELISA Kit

Sign In for Pricing
View Details
Bovine Secreted Frizzled Related Protein 4 ELISA Kit
MBS7264111-02 96 Well

Bovine Secreted Frizzled Related Protein 4 ELISA Kit

Sign In for Pricing
View Details
Bovine Secreted Frizzled Related Protein 4 ELISA Kit
MBS7264111-03 5x 96 Well

Bovine Secreted Frizzled Related Protein 4 ELISA Kit

Sign In for Pricing
View Details
Bovine Secreted Frizzled Related Protein 4 ELISA Kit
MBS7264111-04 10x 96 Well

Bovine Secreted Frizzled Related Protein 4 ELISA Kit

Sign In for Pricing
View Details
Glu-Glu Tag Rabbit pAb, BF680 conjugated
orb2456612 100 µL

Glu-Glu Tag Rabbit pAb, BF680 conjugated

Sign In for Pricing
View Details
CCRF-CEM (Human Acute Lymphoblastic Leukemia) Whole Cell Lysate
E45O00054 100 µg

CCRF-CEM (Human Acute Lymphoblastic Leukemia) Whole Cell Lysate

Sign In for Pricing
View Details