Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCS Peptide - middle region

CCS Peptide - middle region

Product Specifications

Product Name Alternative

MGC138260

UniProt

O14618

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCS Rabbit Polyclonal Antibody (orb584871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005116

Preservative

Lyophilized powder

AA Sequence

LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DEPDC1B Antibody [Alexa Fluor 488]
NBP2-81913AF488 0.1 mL

Rabbit Polyclonal DEPDC1B Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
Lentiviral human PRELID3B shRNA (UAS) - Lentiviral human PRELID3B shRNA (UAS, iRFP) plasmid
GTR15317263 1 Vial

Lentiviral human PRELID3B shRNA (UAS) - Lentiviral human PRELID3B shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
FDPSL3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0771902 1.0 µg DNA

FDPSL3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details