Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cct7 Peptide - C-terminal region

Cct7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA408524, AL022769, Ccth, Cctz

UniProt

P80313

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cct7 Rabbit Polyclonal Antibody (orb581456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031664

Preservative

Lyophilized powder

AA Sequence

FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABL2 Protein Vector (Human) (pPB-C-His)
PV060805 500 ng

ABL2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Ricinine
020655 100 mg

Ricinine

Sign In for Pricing
View Details
Anti-GPR124 antibody
STJ93331 200 µl

Anti-GPR124 antibody

Sign In for Pricing
View Details
GSK3 beta (GSK3B) Mouse Monoclonal Antibody [Clone ID: 2E6-D6-C12]
TA384340 100 µL

GSK3 beta (GSK3B) Mouse Monoclonal Antibody [Clone ID: 2E6-D6-C12]

Sign In for Pricing
View Details
Rabbit Anti-Donkey IgG (H&L) - Biotin
orb1786761-01 100 µL

Rabbit Anti-Donkey IgG (H&L) - Biotin

Sign In for Pricing
View Details
Rabbit Anti-Donkey IgG (H&L) - Biotin
orb1786761-02 500 µL

Rabbit Anti-Donkey IgG (H&L) - Biotin

Sign In for Pricing
View Details