Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cct7 Peptide - C-terminal region

Cct7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA408524, AL022769, Ccth, Cctz

UniProt

P80313

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cct7 Rabbit Polyclonal Antibody (orb581456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031664

Preservative

Lyophilized powder

AA Sequence

FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRB3 Peptide - middle region (AAP87219)
AAP87219-100UG 100 µg

ADRB3 Peptide - middle region (AAP87219)

Sign In for Pricing
View Details
MIRacle™ mmu-miR-378b miRNA Agomir/Antagomir
AM3655 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-378b miRNA Agomir/Antagomir

Sign In for Pricing
View Details
IL34 Recombinant Protein
OPCD04420-50UG 50 µg

IL34 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CFTR Protein, C-His
orb3056356-01 50 µg

Recombinant Human CFTR Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CFTR Protein, C-His
orb3056356-02 100 µg

Recombinant Human CFTR Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CFTR Protein, C-His
orb3056356-03 1 mg

Recombinant Human CFTR Protein, C-His

Sign In for Pricing
View Details