Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cct7 Peptide - C-terminal region

Cct7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA408524, AL022769, Ccth, Cctz

UniProt

P80313

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cct7 Rabbit Polyclonal Antibody (orb581456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031664

Preservative

Lyophilized powder

AA Sequence

FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL44 (NM_022915) Human Untagged Clone
SC305065 10 µg

MRPL44 (NM_022915) Human Untagged Clone

Sign In for Pricing
View Details
Phospho-PAK1 /PAK2 (Thr423/Thr402) Peptide
AF4463-BP 1 mg

Phospho-PAK1 /PAK2 (Thr423/Thr402) Peptide

Sign In for Pricing
View Details
Cat Galectin 9B (GAL9B) ELISA Kit
MBS9943201 Inquire

Cat Galectin 9B (GAL9B) ELISA Kit

Sign In for Pricing
View Details
Nori Canine IL-17R ELISA Kit-2 Plates
GR115012-2 2x 96 Well

Nori Canine IL-17R ELISA Kit-2 Plates

Sign In for Pricing
View Details
MTA2 Antibody
MBS8595124-01 0.1 mg

MTA2 Antibody

Sign In for Pricing
View Details
MTA2 Antibody
MBS8595124-02 0.1 mL (AF405L)

MTA2 Antibody

Sign In for Pricing
View Details