Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1A Peptide - C-terminal region

CD1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD1, FCB6, HTA1, R4, T6

UniProt

P06126

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD1A Rabbit Polyclonal Antibody (orb585507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001754

Preservative

Lyophilized powder

AA Sequence

KPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Performance Check Solution
5252-PCS 1 mL

Performance Check Solution

Sign In for Pricing
View Details
AKT3 Antibody (S472)
MBS9203287-01 0.08 mL

AKT3 Antibody (S472)

Sign In for Pricing
View Details
AKT3 Antibody (S472)
MBS9203287-02 0.4 mL

AKT3 Antibody (S472)

Sign In for Pricing
View Details
AKT3 Antibody (S472)
MBS9203287-03 5x 0.4 mL

AKT3 Antibody (S472)

Sign In for Pricing
View Details
Rabbit anti-ERG Antibody
DL95907A-01 50 µL

Rabbit anti-ERG Antibody

Sign In for Pricing
View Details
Rabbit anti-ERG Antibody
DL95907A-02 100 µL

Rabbit anti-ERG Antibody

Sign In for Pricing
View Details