Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1A Peptide - C-terminal region

CD1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD1, FCB6, HTA1, R4, T6

UniProt

P06126

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD1A Rabbit Polyclonal Antibody (orb585507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001754

Preservative

Lyophilized powder

AA Sequence

KPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC delta
329736-01 50 µg

PKC delta

Sign In for Pricing
View Details
PKC delta
329736-02 100 µg

PKC delta

Sign In for Pricing
View Details
Mlf1 Antibody - middle region
OAAB18847-400UL 400 µL

Mlf1 Antibody - middle region

Sign In for Pricing
View Details
HPV58 L1/Major capsid protein L1
E55A12348 100 µg

HPV58 L1/Major capsid protein L1

Sign In for Pricing
View Details
JMJD2B, phosphorylated (S622) (KDM4B, JHDM3B, JMJD2B, KIAA0876, Lysine-specific demethylase 4B, JmjC domain-containing histone demethylation protein 3B, Jumonji domain-containing protein 2B) (FITC) discontinued
037203-FITC 200 µL

JMJD2B, phosphorylated (S622) (KDM4B, JHDM3B, JMJD2B, KIAA0876, Lysine-specific demethylase 4B, JmjC domain-containing histone demethylation protein 3B, Jumonji domain-containing protein 2B) (FITC) discontinued

Sign In for Pricing
View Details
Protein kinase D inhibitor 1
orb1688876-01 25 mg

Protein kinase D inhibitor 1

Sign In for Pricing
View Details