Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2 Peptide - C-terminal region

CD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ46032, SRBC, T11

UniProt

P06729

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD2 Rabbit Polyclonal Antibody (orb585489) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001758

Preservative

Lyophilized powder

AA Sequence

VALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH18 (Ey-Cadherin, Cadherin-18, Cadherin-14, CDH14) (PE)
124768-PE 100 µL

CDH18 (Ey-Cadherin, Cadherin-18, Cadherin-14, CDH14) (PE)

Sign In for Pricing
View Details
Rcan2 (NM_175578) Rat Tagged Lenti ORF Clone
RR207596L4 10 µg

Rcan2 (NM_175578) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Heart Fatty Acid Binding Protein ELISA Kit
MBS732173-01 48 Strip Well (Competitive)

Human Heart Fatty Acid Binding Protein ELISA Kit

Sign In for Pricing
View Details
Human Heart Fatty Acid Binding Protein ELISA Kit
MBS732173-02 48 Strip Well (Sandwich)

Human Heart Fatty Acid Binding Protein ELISA Kit

Sign In for Pricing
View Details
Human Heart Fatty Acid Binding Protein ELISA Kit
MBS732173-03 96 Strip Well (Competitive)

Human Heart Fatty Acid Binding Protein ELISA Kit

Sign In for Pricing
View Details
Human Heart Fatty Acid Binding Protein ELISA Kit
MBS732173-04 96 Strip Well (Sandwich)

Human Heart Fatty Acid Binding Protein ELISA Kit

Sign In for Pricing
View Details