Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD22 Peptide - C-terminal region

CD22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22814, MGC130020, SIGLEC-2, SIGLEC2

UniProt

P20273

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD22 Rabbit Polyclonal Antibody (orb584484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001762

Preservative

Lyophilized powder

AA Sequence

YSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR158 Double Nickase Plasmid (h)
sc-407138-NIC 20 µg

GPR158 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Cupric sulfate
E0162-1g 1 g

Cupric sulfate

Sign In for Pricing
View Details
ErbB-3 (phospho Tyr1222) Polyclonal Antibody
ABP54152-01 30 µL

ErbB-3 (phospho Tyr1222) Polyclonal Antibody

Sign In for Pricing
View Details
ErbB-3 (phospho Tyr1222) Polyclonal Antibody
ABP54152-02 100 µL

ErbB-3 (phospho Tyr1222) Polyclonal Antibody

Sign In for Pricing
View Details
ErbB-3 (phospho Tyr1222) Polyclonal Antibody
ABP54152-03 200 µL

ErbB-3 (phospho Tyr1222) Polyclonal Antibody

Sign In for Pricing
View Details
Orexin receptor 1+2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1095R-BF594-TR 20 µL

Orexin receptor 1+2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details