Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD22 Peptide - C-terminal region

CD22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22814, MGC130020, SIGLEC-2, SIGLEC2

UniProt

P20273

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD22 Rabbit Polyclonal Antibody (orb584484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001762

Preservative

Lyophilized powder

AA Sequence

YSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine ACVRL1 Protein, Fc Tag
PCA164 100 µg

Canine ACVRL1 Protein, Fc Tag

Sign In for Pricing
View Details
FAPα CRISPR Activation Plasmid (h2)
sc-401511-ACT-2 20 µg

FAPα CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Human CYP51A1 knockdown cell line
ABC-KD3894 1 Vial

Human CYP51A1 knockdown cell line

Sign In for Pricing
View Details
Printed, assembled Screw Cap Tube, Conical, PP, 1.5 mL, with EPDM ring Cap, Yellow - 1000 un, DNase/RNase free - ABDOS
P50233Y 1000 Units/Pack

Printed, assembled Screw Cap Tube, Conical, PP, 1.5 mL, with EPDM ring Cap, Yellow - 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details
IGKV2OR2-4 Adenovirus (Human)
24643051 1.0 mL

IGKV2OR2-4 Adenovirus (Human)

Sign In for Pricing
View Details
MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (MaxLight 490) discontinued
M2749-32G-ML490 100 µL

MCM4 (Minichromosome Maintenance Deficient 4, CDC21, CDC21 Homolog, CDC54, DNA Replication Licensing Factor MCM4, hCdc21, Homolog of S. pombe Cell Devision Cycle 21, MGC33310, Minichromosome Maintenance 4, Minichromosome Maintenance Complex Component 4, P1-CDC21) (MaxLight 490) discontinued

Sign In for Pricing
View Details