Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD244 Peptide - C-terminal region

CD244 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2B4, NAIL, NKR2B4, Nmrk, SLAMF4

UniProt

B2R820

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD244 Rabbit Polyclonal Antibody (orb585003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057466

Preservative

Lyophilized powder

AA Sequence

FRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDBP (hydrochloride)
HY-W509178-01 1 mg

MDBP (hydrochloride)

Sign In for Pricing
View Details
MDBP (hydrochloride)
HY-W509178-02 5 mg

MDBP (hydrochloride)

Sign In for Pricing
View Details
AKAP13 Antibody
MBS7118918-01 0.05 mg

AKAP13 Antibody

Sign In for Pricing
View Details
AKAP13 Antibody
MBS7118918-02 0.1 mg

AKAP13 Antibody

Sign In for Pricing
View Details
AKAP13 Antibody
MBS7118918-03 5x 0.1 mg

AKAP13 Antibody

Sign In for Pricing
View Details
FGF22 Antibody (FITC)
orb414743-01 50 µg

FGF22 Antibody (FITC)

Sign In for Pricing
View Details