Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD27 Peptide - C-terminal region

CD27 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC20393, S152, T14, TNFRSF7, Tp55

UniProt

P26842

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD27 Rabbit Polyclonal Antibody (orb331016) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001233

Preservative

Lyophilized powder

AA Sequence

LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZCCHC9 shRNA (UAS) - Lentiviral human ZCCHC9 shRNA (UAS, iRFP) (25)
GTR15339737 1 Vial

Lentiviral human ZCCHC9 shRNA (UAS) - Lentiviral human ZCCHC9 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Sgk269, ID (Peak1, Kiaa2002, Sgk269, Pseudopodium-enriched atypical kinase 1, Sugen kinase 269, Tyrosine-protein kinase SgK269) (MaxLight 405) discontinued
041661-ML405 100 µL

Sgk269, ID (Peak1, Kiaa2002, Sgk269, Pseudopodium-enriched atypical kinase 1, Sugen kinase 269, Tyrosine-protein kinase SgK269) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Thrombospondin 1 (C-8) Alexa Fluor® 594
sc-393504 AF594 200 µg/mL

Thrombospondin 1 (C-8) Alexa Fluor® 594

Sign In for Pricing
View Details
Pi4KIIalpha Antibody
SAB312-01 50 µL

Pi4KIIalpha Antibody

Sign In for Pricing
View Details
Pi4KIIalpha Antibody
SAB312-02 100 µL

Pi4KIIalpha Antibody

Sign In for Pricing
View Details
Carbohydrate Antigen 15-3 (CA15-3) Antibody
E63C01101 100 µg -100 µL

Carbohydrate Antigen 15-3 (CA15-3) Antibody

Sign In for Pricing
View Details