Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD27 Peptide - C-terminal region

CD27 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC20393, S152, T14, TNFRSF7, Tp55

UniProt

P26842

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD27 Rabbit Polyclonal Antibody (orb331016) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001233

Preservative

Lyophilized powder

AA Sequence

LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Runt Related Transcription Factor 2 (RUNX2) ELISA Kit
RD-RUNX2-Ra-01 96 Tests

Rat Runt Related Transcription Factor 2 (RUNX2) ELISA Kit

Sign In for Pricing
View Details
Rat Runt Related Transcription Factor 2 (RUNX2) ELISA Kit
RD-RUNX2-Ra-02 48 Tests

Rat Runt Related Transcription Factor 2 (RUNX2) ELISA Kit

Sign In for Pricing
View Details
RPS2 ORF Vector (Human) (pORF)
42208011 1.0 µg DNA

RPS2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
53BP1 (TP53BP1) Mouse Monoclonal Antibody [Clone ID: OTI12D4]
TA807151 100 µL

53BP1 (TP53BP1) Mouse Monoclonal Antibody [Clone ID: OTI12D4]

Sign In for Pricing
View Details
IFITM2 Mouse Monoclonal Antibody [Clone ID: OTI6F7]
TA811629 100 µL

IFITM2 Mouse Monoclonal Antibody [Clone ID: OTI6F7]

Sign In for Pricing
View Details
Recombinant Rhesus Macaque MMP28 Protein, His (Fc)-Avi-tagged
MMP28-2614R 50 µg

Recombinant Rhesus Macaque MMP28 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details