Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28 Peptide - C-terminal region

CD28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC138290, Tp44

UniProt

P10747

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD28 Rabbit Polyclonal Antibody (orb584218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006130

Preservative

Lyophilized powder

AA Sequence

TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-13 (Interleukin 13) CLIA Kit
E-CL-M0460-01 24 Tests

Mouse IL-13 (Interleukin 13) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-13 (Interleukin 13) CLIA Kit
E-CL-M0460-02 48 Tests

Mouse IL-13 (Interleukin 13) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-13 (Interleukin 13) CLIA Kit
E-CL-M0460-03 96 Tests

Mouse IL-13 (Interleukin 13) CLIA Kit

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (AE-2), 0.2mg/mL
BNUB0946-100 1x 100 µL

Double Stranded DNA (dsDNA) (AE-2), 0.2mg/mL

Sign In for Pricing
View Details
2’-Nitrophenyl 2,3,4-Tri-O-acetyl-Beta-D-xylopyranoside
TRC-N506985-10MG 10 mg

2’-Nitrophenyl 2,3,4-Tri-O-acetyl-Beta-D-xylopyranoside

Sign In for Pricing
View Details
MRTFA Mouse Monoclonal Antibody [Clone ID: OTI2B9]
CF805131 100 µg

MRTFA Mouse Monoclonal Antibody [Clone ID: OTI2B9]

Sign In for Pricing
View Details