Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28 Peptide - C-terminal region

CD28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC138290, Tp44

UniProt

P10747

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD28 Rabbit Polyclonal Antibody (orb584218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006130

Preservative

Lyophilized powder

AA Sequence

TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2-(2-Formamidothiazol-4-yl)-2-oxoacetate
TRC-E717770-250MG 250 mg

Ethyl 2-(2-Formamidothiazol-4-yl)-2-oxoacetate

Sign In for Pricing
View Details
BCOR Antibody
8C12072-AAT 50 µg

BCOR Antibody

Sign In for Pricing
View Details
Human LIAS, N-Twin Strep, C-His, Flag Tag
HA210500-01 20 µg

Human LIAS, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human LIAS, N-Twin Strep, C-His, Flag Tag
HA210500-02 50 µg

Human LIAS, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human LIAS, N-Twin Strep, C-His, Flag Tag
HA210500-03 100 µg

Human LIAS, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
PGK1 Antibody
OC-112-01 50 μL

PGK1 Antibody

Sign In for Pricing
View Details