Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD34 Peptide - C-terminal region

CD34 Peptide - C-terminal region

Product Specifications

UniProt

Q3C1E7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD34 Rabbit Polyclonal Antibody (orb584866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001764

Preservative

Lyophilized powder

AA Sequence

DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGE1 Dimer
TRC-P380080-10MG 10 mg

PGE1 Dimer

Sign In for Pricing
View Details
Poly(Ethylene Adipate)~ 10,000 By GPC
TRC-E249380-250MG 250 mg

Poly(Ethylene Adipate)~ 10,000 By GPC

Sign In for Pricing
View Details
Allobarbital
TRC-A544500-1G 1 g

Allobarbital

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF647 conjugate, 0.1mg/mL
BNC470821-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(S)-(-)-Dropropizine N-Oxide
TRC-D681530-250MG 250 mg

(S)-(-)-Dropropizine N-Oxide

Sign In for Pricing
View Details
L-Tryptophan Benzyl Ester Hydrochloride
TRC-T147110-5G 5 g

L-Tryptophan Benzyl Ester Hydrochloride

Sign In for Pricing
View Details