Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD34 Peptide - C-terminal region

CD34 Peptide - C-terminal region

Product Specifications

UniProt

Q3C1E7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD34 Rabbit Polyclonal Antibody (orb584866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001764

Preservative

Lyophilized powder

AA Sequence

DLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit
RDR-KIF5B-Mu-01 96 Tests

Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit
RDR-KIF5B-Mu-02 48 Tests

Mouse Kinesin Family, Member 5B (KIF5B) ELISA Kit

Sign In for Pricing
View Details
OSBP1 (OSBP) (NM_002556) Human Over-expression Lysate
LY419260 100 µg

OSBP1 (OSBP) (NM_002556) Human Over-expression Lysate

Sign In for Pricing
View Details
EXOSC10 (NM_001001998) Human Recombinant Protein
TP750242 100 µg

EXOSC10 (NM_001001998) Human Recombinant Protein

Sign In for Pricing
View Details
Trichloroacetic Anhydride
TRC-T773555-5G 5 g

Trichloroacetic Anhydride

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD49d Antibody[R1-2]
AN00422UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details