Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38 Peptide - C-terminal region

CD38 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T10

UniProt

P28907

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD38 Rabbit Polyclonal Antibody (orb584222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001766

Preservative

Lyophilized powder

AA Sequence

RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1418 (NM_001000008) Rat Tagged ORF Clone Lentiviral Particle
RR207296L4V 200 µL

Olr1418 (NM_001000008) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PIC 1803-70*70-B7541-CRD Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
811692 6 Card (6 Label (s) x 1 Card)

PIC 1803-70*70-B7541-CRD Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Recombinant Human Protein Wnt-7b (Wnt7b)
orb1631217-01 20 µg

Recombinant Human Protein Wnt-7b (Wnt7b)

Sign In for Pricing
View Details
Recombinant Human Protein Wnt-7b (Wnt7b)
orb1631217-02 100 µg

Recombinant Human Protein Wnt-7b (Wnt7b)

Sign In for Pricing
View Details
Recombinant Human Protein Wnt-7b (Wnt7b)
orb1631217-03 1 mg

Recombinant Human Protein Wnt-7b (Wnt7b)

Sign In for Pricing
View Details
EdU (5-Ethyl-2′-deoxyuridine)
G5059-100MG 100 mg

EdU (5-Ethyl-2′-deoxyuridine)

Sign In for Pricing
View Details