Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38 Peptide - C-terminal region

CD38 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T10

UniProt

P28907

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD38 Rabbit Polyclonal Antibody (orb584222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001766

Preservative

Lyophilized powder

AA Sequence

RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMCN Protein Vector (Rat) (pPB-N-His)
PV266067 500 ng

EMCN Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CAPN1 Rabbit Polyclonal Antibody (APC)
orb999725 100 µL

CAPN1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
GANC Polyclonal Antibody
MBS2559875-01 0.02 mL

GANC Polyclonal Antibody

Sign In for Pricing
View Details
GANC Polyclonal Antibody
MBS2559875-02 0.06 mL

GANC Polyclonal Antibody

Sign In for Pricing
View Details
GANC Polyclonal Antibody
MBS2559875-03 0.12 mL

GANC Polyclonal Antibody

Sign In for Pricing
View Details
GANC Polyclonal Antibody
MBS2559875-04 0.2 mL

GANC Polyclonal Antibody

Sign In for Pricing
View Details