Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E Peptide - middle region

CD3E Peptide - middle region

Product Specifications

Product Name Alternative

FLJ18683, T3E, TCRE

UniProt

P07766

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD3E Rabbit Polyclonal Antibody (orb584219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000724

Preservative

Lyophilized powder

AA Sequence

QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG F (c) Antibody
OARA05261-2MG 2 mg

IgG F (c) Antibody

Sign In for Pricing
View Details
Noggin (NOG) Antibody
abx301877-01 20 µg

Noggin (NOG) Antibody

Sign In for Pricing
View Details
Noggin (NOG) Antibody
abx301877-02 50 µg

Noggin (NOG) Antibody

Sign In for Pricing
View Details
Noggin (NOG) Antibody
abx301877-03 100 µg

Noggin (NOG) Antibody

Sign In for Pricing
View Details
Noggin (NOG) Antibody
abx301877-04 200 µg

Noggin (NOG) Antibody

Sign In for Pricing
View Details
Noggin (NOG) Antibody
abx301877-05 1 mg

Noggin (NOG) Antibody

Sign In for Pricing
View Details