Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3E Peptide - middle region

CD3E Peptide - middle region

Product Specifications

Product Name Alternative

FLJ18683, T3E, TCRE

UniProt

P07766

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD3E Rabbit Polyclonal Antibody (orb584219) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000724

Preservative

Lyophilized powder

AA Sequence

QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hnrnpk shRNA (UAS) - Lentiviral mouse Hnrnpk shRNA (UAS, iRFP) (25)
GTR15213866 1 Vial

Lentiviral mouse Hnrnpk shRNA (UAS) - Lentiviral mouse Hnrnpk shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SIL1 (NM_001037633) Human Over-expression Lysate
E45H04560-2 20 µg

SIL1 (NM_001037633) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Chloro-2,4 (3H,5H) -furandione
EAA97155-01 25 g

3-Chloro-2,4 (3H,5H) -furandione

Sign In for Pricing
View Details
3-Chloro-2,4 (3H,5H) -furandione
EAA97155-02 50 g

3-Chloro-2,4 (3H,5H) -furandione

Sign In for Pricing
View Details
3-Chloro-2,4 (3H,5H) -furandione
EAA97155-03 100 g

3-Chloro-2,4 (3H,5H) -furandione

Sign In for Pricing
View Details
Duck Immunoglobulin E (IgE) ELISA Kit
MBS282530-01 48 Tests

Duck Immunoglobulin E (IgE) ELISA Kit

Sign In for Pricing
View Details