Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47 Peptide - N-terminal region

CD47 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IAP, MER6, OA3

UniProt

Q08722

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD47 Rabbit Polyclonal Antibody (orb585588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001768

Preservative

Lyophilized powder

AA Sequence

FKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbtb20 (NM_001105880) Rat Untagged Clone
RN209351 10 µg

Zbtb20 (NM_001105880) Rat Untagged Clone

Sign In for Pricing
View Details
Eif4a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4652407 1.0 µg DNA

Eif4a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)
MBS1375323-01 0.02 mg (E-Coli)

Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)

Sign In for Pricing
View Details
Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)
MBS1375323-02 0.1 mg (E-Coli)

Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)

Sign In for Pricing
View Details
Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)
MBS1375323-03 0.02 mg (Yeast)

Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)

Sign In for Pricing
View Details
Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)
MBS1375323-04 0.1 mg (Yeast)

Recombinant Aspergillus terreus Probable endo-1,4-beta-xylanase A (xlnA)

Sign In for Pricing
View Details