Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD55 Peptide - middle region

CD55 Peptide - middle region

Product Specifications

Product Name Alternative

CR, CROM, DAF, TC

UniProt

P08174

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD55 Rabbit Polyclonal Antibody (orb584592) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000565

Preservative

Lyophilized powder

AA Sequence

PGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAPK2 (Death-Associated Protein Kinase 2, DRP-1, MGC119312) (MaxLight 405)
MBS6195154-01 0.1 mL

DAPK2 (Death-Associated Protein Kinase 2, DRP-1, MGC119312) (MaxLight 405)

Sign In for Pricing
View Details
DAPK2 (Death-Associated Protein Kinase 2, DRP-1, MGC119312) (MaxLight 405)
MBS6195154-02 5x 0.1 mL

DAPK2 (Death-Associated Protein Kinase 2, DRP-1, MGC119312) (MaxLight 405)

Sign In for Pricing
View Details
MSL2 (male-Specific lethal 2 Homolog (Drosophila), FLJ10546, KIAA1585, MSL-2, MSL2L1, RNF184) (Biotin)
MBS6173963-01 0.1 mL

MSL2 (male-Specific lethal 2 Homolog (Drosophila), FLJ10546, KIAA1585, MSL-2, MSL2L1, RNF184) (Biotin)

Sign In for Pricing
View Details
MSL2 (male-Specific lethal 2 Homolog (Drosophila), FLJ10546, KIAA1585, MSL-2, MSL2L1, RNF184) (Biotin)
MBS6173963-02 5x 0.1 mL

MSL2 (male-Specific lethal 2 Homolog (Drosophila), FLJ10546, KIAA1585, MSL-2, MSL2L1, RNF184) (Biotin)

Sign In for Pricing
View Details
GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)
306995-01 50 µg

GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)

Sign In for Pricing
View Details
GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)
306995-02 100 µg

GOT1 (Aspartate Aminotransferase, Cytoplasmic, cAspAT, Cysteine Aminotransferase, Cytoplasmic, Cysteine Transaminase, Cytoplasmic, cCAT, Glutamate Oxaloacetate Transaminase 1, Transaminase A) (Biotin)

Sign In for Pricing
View Details