CD7 Peptide - middle region
CD7 Peptide - middle region
Product Specifications
Product Name Alternative
GP40, LEU-9, TP41, Tp40
UniProt
P09564
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD7 Rabbit Polyclonal Antibody (orb584225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006128
Preservative
Lyophilized powder
AA Sequence
SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2153009-01 0.1 mL
Monoclonal Antibody to Ciliary Neurotrophic Factor (CNTF)
Sign In for Pricing
View Details MBS2153009-02 0.2 mL
Monoclonal Antibody to Ciliary Neurotrophic Factor (CNTF)
Sign In for Pricing
View Details MBS2153009-03 0.5 mL
Monoclonal Antibody to Ciliary Neurotrophic Factor (CNTF)
Sign In for Pricing
View Details MBS2153009-04 1 mL
Monoclonal Antibody to Ciliary Neurotrophic Factor (CNTF)
Sign In for Pricing
View Details