CD8A Peptide - middle region
CD8A Peptide - middle region
Product Specifications
Product Name Alternative
CD8, Leu2, MAL, p32
UniProt
P01732
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD8A Rabbit Polyclonal Antibody (orb326279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001139345
Preservative
Lyophilized powder
AA Sequence
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
S1014-65C-ML550 100 µL
SMURF2 (Smad Ubiquitination Regulatory Factor 2, E3 Ubiquitin-Protein Ligase SMURF2, Smad-Specific E3 Ubiquitin Ligase 2) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
K1865103 1.0 µg DNA
RNY4P8 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details MBS6273877-01 0.2 mL
ANR44, ID (ANKRD44, Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B, Ankyrin repeat domain-containing protein 44) (Azide free) (HRP)
Sign In for Pricing
View Details