Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8A Peptide - middle region

CD8A Peptide - middle region

Product Specifications

Product Name Alternative

CD8, Leu2, MAL, p32

UniProt

P01732

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD8A Rabbit Polyclonal Antibody (orb326280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139345

Preservative

Lyophilized powder

AA Sequence

GKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC4 (NM_001134388) Human Tagged Lenti ORF Clone
RC225512L3 10 µg

ZDHHC4 (NM_001134388) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rno-miR-2985 miRNA Mimic
orb1873602-01 5 nmol

Rno-miR-2985 miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-2985 miRNA Mimic
orb1873602-02 10 nmol

Rno-miR-2985 miRNA Mimic

Sign In for Pricing
View Details
Recombinant Multidrug resistance-like ATP-binding protein MdlB (mdlB)
orb2908773-01 20 µg

Recombinant Multidrug resistance-like ATP-binding protein MdlB (mdlB)

Sign In for Pricing
View Details
Recombinant Multidrug resistance-like ATP-binding protein MdlB (mdlB)
orb2908773-02 100 µg

Recombinant Multidrug resistance-like ATP-binding protein MdlB (mdlB)

Sign In for Pricing
View Details
TIM 1 (HAVCR1) (NM_012206) Human Over-expression Lysate
LY415915 100 µg

TIM 1 (HAVCR1) (NM_012206) Human Over-expression Lysate

Sign In for Pricing
View Details