CD8A Peptide - middle region
CD8A Peptide - middle region
Product Specifications
Product Name Alternative
CD8, Leu2, MAL, p32
UniProt
P01732
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD8A Rabbit Polyclonal Antibody (orb326280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001139345
Preservative
Lyophilized powder
AA Sequence
GKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740096-500 1x 500 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880158-500 1x 500 µL
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400862-100 1x 100 µL
Glypican-3 (1G12), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details