Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8A Peptide - middle region

CD8A Peptide - middle region

Product Specifications

Product Name Alternative

CD8, Leu2, MAL, p32

UniProt

P01732

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD8A Rabbit Polyclonal Antibody (orb326280) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139345

Preservative

Lyophilized powder

AA Sequence

GKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERR2 Polyclonal Antibody
JOT-AP15466-01 20 µL

ERR2 Polyclonal Antibody

Sign In for Pricing
View Details
ERR2 Polyclonal Antibody
JOT-AP15466-02 50 μL

ERR2 Polyclonal Antibody

Sign In for Pricing
View Details
ERR2 Polyclonal Antibody
JOT-AP15466-03 100 µL

ERR2 Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-4705 agomir
HY-R01288A-01 5 nmol

Hsa-miR-4705 agomir

Sign In for Pricing
View Details
Hsa-miR-4705 agomir
HY-R01288A-02 20 nmol

Hsa-miR-4705 agomir

Sign In for Pricing
View Details
2'- , 2''- O- (Di- methyl) - cyclic diadenosine monophosphate (2',2''-Di-O-Me-c-diAMP), sodium salt
D 154-001 0.1 µmol ~ 69 µg

2'- , 2''- O- (Di- methyl) - cyclic diadenosine monophosphate (2',2''-Di-O-Me-c-diAMP), sodium salt

Sign In for Pricing
View Details