Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC26 Peptide - C-terminal region

CDC26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf17, APC12, ANAPC12

UniProt

Q8NHZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_644815

Preservative

Lyophilized powder

AA Sequence

KQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque CENPW Protein, His (Fc)-Avi-tagged
CENPW-641R 50 µg

Recombinant Rhesus Macaque CENPW Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SNPH Recombinant Rabbit mAb
orb2326298-01 25 µL

SNPH Recombinant Rabbit mAb

Sign In for Pricing
View Details
SNPH Recombinant Rabbit mAb
orb2326298-02 50 µL

SNPH Recombinant Rabbit mAb

Sign In for Pricing
View Details
SNPH Recombinant Rabbit mAb
orb2326298-03 100 µL

SNPH Recombinant Rabbit mAb

Sign In for Pricing
View Details
Cdk7 (h7) : 293 Lysate
sc-158371 100 µg - 200 µL

Cdk7 (h7) : 293 Lysate

Sign In for Pricing
View Details
Ibufenac Acyl-Beta-D-Glucuronide
TRC-I130005-10MG 10 mg

Ibufenac Acyl-Beta-D-Glucuronide

Sign In for Pricing
View Details