Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC26 Peptide - C-terminal region

CDC26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf17, APC12, ANAPC12

UniProt

Q8NHZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_644815

Preservative

Lyophilized powder

AA Sequence

KQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpt2 3'UTR Luciferase Stable Cell Line
TU205416 1.0 mL

Gpt2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CCKAR Antibody
A45455-50UL 50 μL

CCKAR Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GIT1 Antibody
NBP1-86144 0.1 mL

Rabbit Polyclonal GIT1 Antibody

Sign In for Pricing
View Details
GDA Recombinant Protein
32-2355-20 20 µg

GDA Recombinant Protein

Sign In for Pricing
View Details
ZHD1 Antibody
orb799096 2 mg

ZHD1 Antibody

Sign In for Pricing
View Details
Oct4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-63076R-BF680 100 µL

Oct4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details