Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC37L1 Peptide - C-terminal region

CDC37L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDC37B, FLJ20639, HARC, RP11-6J24.5

UniProt

Q7L3B6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC37L1 Rabbit Polyclonal Antibody (orb331186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060383

Preservative

Lyophilized powder

AA Sequence

EQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF740 conjugate, 0.1mg/mL
BNC741210-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tenascin C (TNC)
MBS2061392-01 0.1 mL

FITC-Linked Monoclonal Antibody to Tenascin C (TNC)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tenascin C (TNC)
MBS2061392-02 0.2 mL

FITC-Linked Monoclonal Antibody to Tenascin C (TNC)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tenascin C (TNC)
MBS2061392-03 0.5 mL

FITC-Linked Monoclonal Antibody to Tenascin C (TNC)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tenascin C (TNC)
MBS2061392-04 1 mL

FITC-Linked Monoclonal Antibody to Tenascin C (TNC)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tenascin C (TNC)
MBS2061392-05 5 mL

FITC-Linked Monoclonal Antibody to Tenascin C (TNC)

Sign In for Pricing
View Details