Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC37L1 Peptide - C-terminal region

CDC37L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDC37B, FLJ20639, HARC, RP11-6J24.5

UniProt

Q7L3B6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC37L1 Rabbit Polyclonal Antibody (orb331186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060383

Preservative

Lyophilized powder

AA Sequence

EQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASH2L (NM_001282272) Human Tagged ORF Clone
RG238519 10 µg

ASH2L (NM_001282272) Human Tagged ORF Clone

Sign In for Pricing
View Details
VCP (Valosin-Containing Protein, IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97) (Biotin)
MBS6173719-01 0.1 mL

VCP (Valosin-Containing Protein, IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97) (Biotin)

Sign In for Pricing
View Details
VCP (Valosin-Containing Protein, IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97) (Biotin)
MBS6173719-02 5x 0.1 mL

VCP (Valosin-Containing Protein, IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97) (Biotin)

Sign In for Pricing
View Details
C1orf69 (IBA57) Human qPCR Primer Pair (NM_001010867)
HP202052 200 Reactions

C1orf69 (IBA57) Human qPCR Primer Pair (NM_001010867)

Sign In for Pricing
View Details
Anti-TMOD1 antibody
STJ111213 100 µl

Anti-TMOD1 antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl K16) Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1813250 100 µL

Histone H4 (Acetyl K16) Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details