Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdc42ep4 Peptide - middle region

Cdc42ep4 Peptide - middle region

Product Specifications

UniProt

B1WC33

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdc42ep4 Rabbit Polyclonal Antibody (orb582511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100533

Preservative

Lyophilized powder

AA Sequence

GSPKSPHRNGATGPHSPDPLLDEQAFGDLMDLPVMPKVSYGLKHAESILS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL
BNC882298-100 1x 100 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chicken Fibroblast Growth Factor 4 (FGF4) ELISA Kit
RDR-FGF4-Ch-01 96 Tests

Chicken Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details
Chicken Fibroblast Growth Factor 4 (FGF4) ELISA Kit
RDR-FGF4-Ch-02 48 Tests

Chicken Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details
CTLA4 Antibody
KC-294-01 50 μL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-294-02 100 µL

CTLA4 Antibody

Sign In for Pricing
View Details
CTLA4 Antibody
KC-294-03 1 mL

CTLA4 Antibody

Sign In for Pricing
View Details