Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA4 Peptide - middle region

CDCA4 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20764, FLJ52878, HEPP, MGC19517, SEI-3/HEPP

UniProt

Q9BXL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDCA4 Rabbit Polyclonal Antibody (orb581150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060425

Preservative

Lyophilized powder

AA Sequence

SSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLP-2 Human peptide
orb216623-01 1 mg

GLP-2 Human peptide

Sign In for Pricing
View Details
GLP-2 Human peptide
orb216623-02 5 mg

GLP-2 Human peptide

Sign In for Pricing
View Details
GLP-2 Human peptide
orb216623-03 10 mg

GLP-2 Human peptide

Sign In for Pricing
View Details
CXCR2 Antibody; FITC conjugated
MBS7002749-01 0.05 mg

CXCR2 Antibody; FITC conjugated

Sign In for Pricing
View Details
CXCR2 Antibody; FITC conjugated
MBS7002749-02 0.1 mg

CXCR2 Antibody; FITC conjugated

Sign In for Pricing
View Details
CXCR2 Antibody; FITC conjugated
MBS7002749-03 5x 0.1 mg

CXCR2 Antibody; FITC conjugated

Sign In for Pricing
View Details