Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA4 Peptide - middle region

CDCA4 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20764, FLJ52878, HEPP, MGC19517, SEI-3/HEPP

UniProt

Q9BXL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDCA4 Rabbit Polyclonal Antibody (orb581150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060425

Preservative

Lyophilized powder

AA Sequence

SSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 5-methyl-1H-pyrrole-2-carboxylate
449450-01 100 mg

Ethyl 5-methyl-1H-pyrrole-2-carboxylate

Sign In for Pricing
View Details
Ethyl 5-methyl-1H-pyrrole-2-carboxylate
449450-02 250 mg

Ethyl 5-methyl-1H-pyrrole-2-carboxylate

Sign In for Pricing
View Details
RBBP5 Blocking Peptide (C-term)
MBS9230157-01 0.5 mg

RBBP5 Blocking Peptide (C-term)

Sign In for Pricing
View Details
RBBP5 Blocking Peptide (C-term)
MBS9230157-02 5x 0.5 mg

RBBP5 Blocking Peptide (C-term)

Sign In for Pricing
View Details
ATP6V1D Polyclonal Antibody
MBS9132720-01 0.02 mL

ATP6V1D Polyclonal Antibody

Sign In for Pricing
View Details
ATP6V1D Polyclonal Antibody
MBS9132720-02 0.1 mL

ATP6V1D Polyclonal Antibody

Sign In for Pricing
View Details