CDCA5 Peptide - middle region
CDCA5 Peptide - middle region
Product Specifications
Product Name Alternative
MGC16386, SORORIN
UniProt
Q96FF9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDCA5 Rabbit Polyclonal Antibody (orb583935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_542399
Preservative
Lyophilized powder
AA Sequence
RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1196593-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O7:K1 Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1196593-02 0.1 mg (E-Coli)
Recombinant Escherichia coli O7:K1 Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1196593-03 0.02 mg (Yeast)
Recombinant Escherichia coli O7:K1 Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1196593-04 0.1 mg (Yeast)
Recombinant Escherichia coli O7:K1 Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1196593-05 0.02 mg (Baculovirus)
Recombinant Escherichia coli O7:K1 Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1196593-06 1 mg (E-Coli)
Recombinant Escherichia coli O7:K1 Acyl carrier protein (acpP)
Sign In for Pricing
View Details