CDK2 Peptide - middle region
CDK2 Peptide - middle region
Product Specifications
Product Name Alternative
P33 (CDK2)
UniProt
P24941
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDK2 Rabbit Polyclonal Antibody (orb573625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001789
Preservative
Lyophilized powder
AA Sequence
VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HMD5213-03 9600 Reactions
LAMP fluorescent master mix (Liquid, Lyoph-Ready)
Sign In for Pricing
View Details 360836-01 50 µL
NAA20 (N-alpha-Acetyltransferase 20, Methionine N-Acetyltransferase, N-Acetyltransferase 5, N-terminal Acetyltransferase B Complex Catalytic Subunit, N-terminal Acetyltransferase B Complex Catalytic Subunit NAT5, NatB Complex Subunit NAT5, NatB Catalytic s) discontinued
Sign In for Pricing
View Details 360836-02 100 µL
NAA20 (N-alpha-Acetyltransferase 20, Methionine N-Acetyltransferase, N-Acetyltransferase 5, N-terminal Acetyltransferase B Complex Catalytic Subunit, N-terminal Acetyltransferase B Complex Catalytic Subunit NAT5, NatB Complex Subunit NAT5, NatB Catalytic s) discontinued
Sign In for Pricing
View Details