Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK20 Peptide - N-terminal region

CDK20 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCRK, CDCH, P42, PNQALRE

UniProt

Q8IZL9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK20 Rabbit Polyclonal Antibody (orb585243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164111

Preservative

Lyophilized powder

AA Sequence

GIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Acetimidate Hydrochloride (>90%)
TRC-E898828-5G 5 g

Ethyl Acetimidate Hydrochloride (>90%)

Sign In for Pricing
View Details
GMFG Polyclonal Antibody
E-AB-10913-01 20 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
GMFG Polyclonal Antibody
E-AB-10913-02 60 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
GMFG Polyclonal Antibody
E-AB-10913-03 120 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
GMFG Polyclonal Antibody
E-AB-10913-04 200 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
Human SMIM17 activation kit by CRISPRa
GA115618 1 Kit

Human SMIM17 activation kit by CRISPRa

Sign In for Pricing
View Details