Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk5r1 Peptide - C-terminal region

Cdk5r1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdk5r, D11Bwg0379e, p25, p35

UniProt

P61809

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdk5r1 Rabbit Polyclonal Antibody (orb573600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034001

Preservative

Lyophilized powder

AA Sequence

EAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Membrane cofactor protein
E1275p 96 Tests

ELISA Kit For Membrane cofactor protein

Sign In for Pricing
View Details
GLI3 Rabbit mAb
52307 50 µL

GLI3 Rabbit mAb

Sign In for Pricing
View Details
PRR20B AAV Vector (Human) (CMV)
37793101 1 µg

PRR20B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rtp2 (NM_001008230) Mouse Tagged Lenti ORF Clone
MR202581L3 10 µg

Rtp2 (NM_001008230) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MEOX2 Antibody
MBS9604654-01 0.1 mL

MEOX2 Antibody

Sign In for Pricing
View Details
MEOX2 Antibody
MBS9604654-02 0.2 mL

MEOX2 Antibody

Sign In for Pricing
View Details