Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk5r1 Peptide - C-terminal region

Cdk5r1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdk5r, D11Bwg0379e, p25, p35

UniProt

P61809

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdk5r1 Rabbit Polyclonal Antibody (orb573600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034001

Preservative

Lyophilized powder

AA Sequence

EAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epha2 (NM_010139) Mouse Recombinant Protein
TP526151 20 µg

Epha2 (NM_010139) Mouse Recombinant Protein

Sign In for Pricing
View Details
PXT1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38241124 3x 1.0µg DNA

PXT1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Human G-CSF (Granulocyte Colony-stimulating Factor) ELISA Kit
E-EL-H0079-01 24 Tests

Human G-CSF (Granulocyte Colony-stimulating Factor) ELISA Kit

Sign In for Pricing
View Details
Human G-CSF (Granulocyte Colony-stimulating Factor) ELISA Kit
E-EL-H0079-02 48 Tests

Human G-CSF (Granulocyte Colony-stimulating Factor) ELISA Kit

Sign In for Pricing
View Details
Human G-CSF (Granulocyte Colony-stimulating Factor) ELISA Kit
E-EL-H0079-03 96 Tests

Human G-CSF (Granulocyte Colony-stimulating Factor) ELISA Kit

Sign In for Pricing
View Details
Milbemycin α14
HY-N15096 1 Each

Milbemycin α14

Sign In for Pricing
View Details