Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk5rap1 Peptide - C-terminal region

Cdk5rap1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdk5rap1

UniProt

Q9JLH6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdk5rap1 Rabbit Polyclonal Antibody (orb583363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663773

Preservative

Lyophilized powder

AA Sequence

VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLRC2 Antibody
F54459-0.4ML 0.4 mL

KLRC2 Antibody

Sign In for Pricing
View Details
PLEKHB2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
36984111 3x 1.0 µg

PLEKHB2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Phospho-HOMER3 (Thr36) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-5392R-APC-Cy5.5 100 µL

Phospho-HOMER3 (Thr36) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
RSPH6A Rabbit Polyclonal Antibody (HRP)
orb2085035 100 µL

RSPH6A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NDUFA12
CSB-CL883413HU 10 μg Plasmid + 200 μL Glycerol

NDUFA12

Sign In for Pricing
View Details
HSP60 monoclonal antibody
MB66075 50ul

HSP60 monoclonal antibody

Sign In for Pricing
View Details