Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk5rap1 Peptide - C-terminal region

Cdk5rap1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdk5rap1

UniProt

Q9JLH6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdk5rap1 Rabbit Polyclonal Antibody (orb583363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663773

Preservative

Lyophilized powder

AA Sequence

VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Explorer™ Fixable Live Cell Tracking Kit *Red Fluorescence*
22625-AAT 200 Tests

Cell Explorer™ Fixable Live Cell Tracking Kit *Red Fluorescence*

Sign In for Pricing
View Details
Phospho-FOXO1 (Ser256) Rabbit pAb, 1 pack = 50 µL
BAL2431 1 Each

Phospho-FOXO1 (Ser256) Rabbit pAb, 1 pack = 50 µL

Sign In for Pricing
View Details
(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol
OR1091139-01 250 mg

(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol

Sign In for Pricing
View Details
(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol
OR1091139-02 500 mg

(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol

Sign In for Pricing
View Details
C1orf64 Antibody, Biotin conjugated
A64012-100UG 100 µg

C1orf64 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rnmtl1 ORF Vector (Mouse) (pORF)
40330014 1.0 µg DNA

Rnmtl1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details