Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL5 Peptide - C-terminal region

CDKL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ISSX, STK9, EIEE2

UniProt

O76039

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKL5 Rabbit Polyclonal Antibody (orb331071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003150

Preservative

Lyophilized powder

AA Sequence

SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC2 Rabbit Polyclonal Antibody (HRP)
orb2597793 100 µg

RCC2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PRKCA Antibody
MBS8510371-01 0.1 mg

PRKCA Antibody

Sign In for Pricing
View Details
PRKCA Antibody
MBS8510371-02 0.1 mL (AF635)

PRKCA Antibody

Sign In for Pricing
View Details
PRKCA Antibody
MBS8510371-03 0.1 mL (AF610)

PRKCA Antibody

Sign In for Pricing
View Details
PRKCA Antibody
MBS8510371-04 0.1 mL (AF405S)

PRKCA Antibody

Sign In for Pricing
View Details
PRKCA Antibody
MBS8510371-05 0.1 mL (AF405L)

PRKCA Antibody

Sign In for Pricing
View Details