Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdkn3 Peptide - N-terminal region

Cdkn3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410006H10Rik

UniProt

Q810P3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdkn3 Rabbit Polyclonal Antibody (orb582156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082498

Preservative

Lyophilized powder

AA Sequence

LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(heptadecafluorooctyl)phosphinic Acid
TRC-B443745-50MG 50 mg

Bis(heptadecafluorooctyl)phosphinic Acid

Sign In for Pricing
View Details
PGAM5 Recombinant Rabbit monoclonal Antibody
HA723364 100 µL

PGAM5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Ccr5 activation kit by CRISPRa
GA200776 1 Kit

Mouse Ccr5 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Cripto-1/TDGF1, C-His, Flag Tag
HA210543-01 20 µg

Human Cripto-1/TDGF1, C-His, Flag Tag

Sign In for Pricing
View Details
Human Cripto-1/TDGF1, C-His, Flag Tag
HA210543-02 50 µg

Human Cripto-1/TDGF1, C-His, Flag Tag

Sign In for Pricing
View Details
Human Cripto-1/TDGF1, C-His, Flag Tag
HA210543-03 100 µg

Human Cripto-1/TDGF1, C-His, Flag Tag

Sign In for Pricing
View Details